PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa11g061670.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family GRAS
Protein Properties Length: 395aa    MW: 43755.9 Da    PI: 7.0734
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa11g061670.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS384.99.6e-118273882373
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetseknsseelaalklfsevsPilkfsh 95 
                      +lLl+cAe v++++l++a+ lL+++se++sp g++ +R++ayf++AL++r+ +   s+ ++ l+ ++ s  +s++ ++al++f+ vsP++kfsh
  Csa11g061670.1  27 LSLLLQCAEYVATDHLREASILLSEISEICSPFGSSPERVVAYFAQALQTRVISsYLSRACSPLSEKPLSVAQSQKIFSALQTFNSVSPLIKFSH 121
                     689************************************************9997889999999999999999********************** PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledle 190
                     +taNqaI +a++ge+ vHiiD+d++qGlQWpaL++ LasRp++  s+RiTg+gs    s++ l +tg+rLa+fA++l++pfef+++  k  + +e
  Csa11g061670.1 122 FTANQAIFQALDGEDSVHIIDLDVMQGLQWPALFHILASRPRKLRSIRITGFGS----SSDLLASTGRRLADFASSLNLPFEFHPIEGKIGNLIE 212
                     ******************************************************....9**************************988888899* PP

            GRAS 191 leeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadh.nsesFlerflealeyysalfdsleaklpreseerik 284
                     +++L +++gEa++V+++   hrl+d +++  +    +++++++l+P++++vveqe+++ +++sFl rf+eal+yysalfd+l  +l++es er  
  Csa11g061670.1 213 PSQLGTRQGEAVVVHWMQ--HRLYDVTGNELE----TVEILRRLKPNLITVVEQELSYdDGGSFLGRFVEALHYYSALFDALGDGLGEESGERFA 301
                     *****************9..9**988887777....9*********************8999********************************* PP

            GRAS 285 vErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                     vE+ +l+ ei+n+va+ g  r+ r++   kWre ++++GF+pv+l+ + a+qa lll + +++gy++ ee+g+l lgWkd +L+++SaW
  Csa11g061670.1 302 VEQIVLATEIRNIVAHGGGGRKRRKR--VKWREEFDRVGFRPVSLRGNPATQAGLLLGMLPWNGYTLVEENGTLRLGWKDLSLLTASAW 388
                     ********************988887..89*********************************************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098557.261369IPR005202Transcription factor GRAS
PfamPF035143.3E-11527388IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048366Biological Processleaf development
GO:0090610Biological Processbundle sheath cell fate specification
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 395 aa     Download sequence    Send to blast
MTTKRINRDF PSSKTLENDG AAAIKLLSLL LQCAEYVATD HLREASILLS EISEICSPFG  60
SSPERVVAYF AQALQTRVIS SYLSRACSPL SEKPLSVAQS QKIFSALQTF NSVSPLIKFS  120
HFTANQAIFQ ALDGEDSVHI IDLDVMQGLQ WPALFHILAS RPRKLRSIRI TGFGSSSDLL  180
ASTGRRLADF ASSLNLPFEF HPIEGKIGNL IEPSQLGTRQ GEAVVVHWMQ HRLYDVTGNE  240
LETVEILRRL KPNLITVVEQ ELSYDDGGSF LGRFVEALHY YSALFDALGD GLGEESGERF  300
AVEQIVLATE IRNIVAHGGG GRKRRKRVKW REEFDRVGFR PVSLRGNPAT QAGLLLGMLP  360
WNGYTLVEEN GTLRLGWKDL SLLTASAWIS QPFH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A9e-50263884374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0170670.0AB017067.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MJC20.
GenBankBT0297600.0BT029760.1 Arabidopsis thaliana At5g41920 mRNA, complete cds.
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010441372.10.0PREDICTED: scarecrow-like protein 23
SwissprotQ9FHZ10.0SCL23_ARATH; Scarecrow-like protein 23
TrEMBLD7MIP90.0D7MIP9_ARALL; Scarecrow transcription factor family protein
STRINGAT5G41920.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM125122631
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41920.10.0GRAS family protein